IL13RA2 Antilichaam - middelste regio : HRP (ARP53558_P050-HRP)

Interleukin 13 receptor, alpha 2

CT19, IL-13R, IL13BP, CD213A2

3598

Q14627

NP_000631

Human, Rat, Rabbit

The immunogen is a synthetic peptide directed towards the middle region of human IL13RA2

IL13RA2 is closely related to Il13RA1, a subuint of the interleukin 13 receptor complex. IL13RA2 binds IL13 with high affinity, but lacks cytoplasmic domain, and does not appear to function as a signal mediator. It is reported to play a role in the internalization of IL13.The protein encoded by this gene is closely related to Il13RA1, a subuint of the interleukin 13 receptor complex. This protein binds IL13 with high affinity, but lacks cytoplasmic domain, and does not appear to function as a signal mediator. It is reported to play a role in the internalization of IL13. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

UBC; IL4; IL13

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Human: 100%; Rabbit: 79%; Rat: 79%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

42kDa

Katsoulotos, G.P., (2008) J. Biol. Chem. 283 (3), 1610-1621

Wet Ice

380

IL13RA2

IL13RA2

Rabbit

Interleukin-13 receptor subunit alpha-2

NM_000640

GQNIGCRFPYLEASDYKDFYICVNGSSENKPIRSSYFTFQLQNIVKPLPP

Alpha-2