IL1A Antibody - N-terminal regio : HRP (ARP54321 P050-HRP)

Interleukin 1, alpha

IL1, IL-1A, IL1F1, IL1-ALPHA, IL-1 alpha

3552

P01583

NP_000566

Human, Mouse, Rat, Goat, Rabbit

The immunogen is a synthetic peptide directed towards the N-terminal region of Human IL1A

The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is a pleiotropic cytokine involved in various immune responses, inflammatory processes, and hematopoiesis. This cytokine is produced by monocytes and macrophages as a proprotein, which is proteolytically processed and released in response to cell injury, and thus induces apoptosis. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. It has been suggested that the polymorphism of these genes is associated with rheumatoid arthritis and Alzheimer's disease.

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity purified

0.5 mg/ml

Goat: 79%; Human: 100%; Mouse: 79%; Rabbit: 79%; Rat: 83%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

29kDa

Wet Ice

271

IL1A

IL1A

Rabbit

Interleukin-1 alpha

VPDMFEDLKNCYSENEEDSSSIDHLSLNQKSFYHVSYGPLHEGCMDQSVS