IL1A Antilichaam - N-terminaal gebied: Biotine (ARP54321 P050-Biotine)

Interleukin 1, alpha

IL1, IL-1A, IL1F1, IL1-ALPHA, IL-1 alpha

3552

P01583

NP_000566

Human, Mouse, Rat, Goat, Rabbit

The immunogen is a synthetic peptide directed towards the N-terminal region of Human IL1A

The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is a pleiotropic cytokine involved in various immune responses, inflammatory processes, and hematopoiesis. This cytokine is produced by monocytes and macrophages as a proprotein, which is proteolytically processed and released in response to cell injury, and thus induces apoptosis. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. It has been suggested that the polymorphism of these genes is associated with rheumatoid arthritis and Alzheimer's disease.

Biotin

Polyclonal Antibody

WB

Affinity purified

0.5 mg/ml

Goat: 79%; Human: 100%; Mouse: 79%; Rabbit: 79%; Rat: 83%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

29kDa

Wet Ice

271

IL1A

IL1A

Rabbit

Interleukin-1 alpha

VPDMFEDLKNCYSENEEDSSSIDHLSLNQKSFYHVSYGPLHEGCMDQSVS