Integrine-β1/CD29 Rabbit pAb (APR24727N)

Integrins are heterodimeric proteins made up of alpha and beta subunits. At least 18 alpha and 8 beta subunits have been described in mammals. Integrin family members are membrane receptors involved in cell adhesion and recognition in a variety of processes including embryogenesis, hemostasis, tissue repair, immune response and metastatic diffusion of tumor cells. This gene encodes a beta subunit. Multiple alternatively spliced transcript variants which encode different protein isoforms have been found for this gene.

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Integrin-β1/CD29 Rabbit pAb (APR24727N) .

CD29; FNRB; GPIIA; MDF2; MSK12; VLA-BETA; VLAB; Integrin beta 1; ITGB1; Integrin β1

3688

P05556

Cell junction, Cell membrane, Cell projection, Cleavage furrow, Melanosome, Recycling endosome, Single-pass type I membrane protein, invadopodium membrane, lamellipodium, ruffle membrane, ruffle, sarcolemma

WB (Homo sapiens, Capra hircus)

WB 1:500 - 1:2000 IF 1:50 - 1:200

Liquid

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Calculated MW: 87kDa/88kDa/91kDa Observed MW: 135KDa

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3688

https://www.uniprot.org/uniprot/P05556

EASNGQICNGRGICECGVCKCTDPKFQGQTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDTCTQECSYFNITKVESRDKLPQPVQPDPVSHCKEKDVDDCW