IRF6 Antilichaam - middengebied: FITC (ARP31995_P050-FITC)

Interferon regulatory factor 6

LPS, PIT, PPS, VWS, OFC6, PPS1, VWS1

3664

O14896

NP_006138

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish

The immunogen is a synthetic peptide directed towards the middle region of human IRF6

IRF6 is a member of the interferon regulatory transcription factor (IRF) family. Family members share a highly-conserved N-terminal helix-turn-helix DNA-binding domain and a less conserved C-terminal protein-binding domain. Mutations in its gene can cause van der Woude syndrome and popliteal pterygium syndrome. This protein is involved in palate formation.The protein encoded by this gene shares strong similarity with Saccharomyces cerevisiae Cdc23, a protein essential for cell cycle progression through the G2/M transition. This protein is a component of anaphase-promoting complex (APC), which is composed of eight protein subunits and highly conserved in eucaryotic cells. APC catalyzes the formation of cyclin B-ubiquitin conjugate that is responsible for the ubiquitin-mediated proteolysis of B-type cyclins. This protein and 3 other members of the APC complex contain the TPR (tetratricopeptide repeat), a protein domain important for protein-protein interaction. This gene encodes a member of the interferon regulatory transcription factor (IRF) family. Family members share a highly-conserved N-terminal helix-turn-helix DNA-binding domain and a less conserved C-terminal protein-binding domain. Mutations in this gene can cause van der Woude syndrome and popliteal pterygium syndrome. This protein is involved in palate formation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

HHV8GK18_gp81; UBC; BNC2; IRF5; IRF8; ZBTB3; RFX3; TLX2; LBP

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

IHC, WB

Affinity Purified

0.5 mg/ml

Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 85%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

53kDa

Vieira, A.R., (er) Arch. Oral Biol. (2008) In press

Wet Ice

467

IRF6

IRF6

Rabbit

Interferon regulatory factor 6

NM_006147

IPVVARMIYEMFSGDFTRSFDSGSVRLQISTPDIKDNIVAQLKQLYRILQ