Jarid2 Antilichaam - middengebied: Biotine (ARP37307 P050-Biotine)

Jumonji, AT rich interactive domain 2

Jmj, jumo, jumonji

16468

Q62315

NP_068678

Human, Mouse, Rat, Dog, Guinea Pig, Rabbit

The immunogen is a synthetic peptide directed towards the middle region of mouse Jarid2

Jarid2 is a regulator of histone methyltransferase complexes that plays an essential role in embryonic development, including heart and liver development, neural tube fusion process and hematopoiesis.Jarid2 acts by modulating histone methyltransferase activity and promoting the recruitment of histone methyltransferase complexes to their target genes.Jarid2 binds DNA and mediates the recruitment of the PRC2 complex to target genes in embryonic stem cells.Jarid2 does not have histone demethylase activity but regulates activity of various histone methyltransferase complexes. In embryonic stem cells, it associates with the PRC2 complex and inhibits trimethylation of 'Lys-27' of histone H3 (H3K27me3) by the PRC2 complex, thereby playing a key role in differentiation of embryonic stem cells and normal development. In cardiac cells, it is required to repress expression of cyclin-D1 (CCND1) by activating methylation of 'Lys-9' of histone H3 (H3K9me) by the GLP1/EHMT1 and G9a/EHMT2 histone methyltransferases.Jarid2 also acts as a transcriptional repressor of ANF via its interaction with GATA4 and NKX2-5.Jarid2 participates in the negative regulation of cell proliferation signaling.

Rb1; Suz12; Ewsr1; Ell; Eed; Aebp2; Morc3; Setx; Stk38l; Thrap3; Ice1; Stk38; Bclaf1; Trim35; Rbbp4; Mtf2; Ezh2; Ezh1

Biotin

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Dog: 79%; Guinea Pig: 79%; Human: 79%; Mouse: 100%; Rabbit: 79%; Rat: 79%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

137kDa

Wet Ice

1234

JARID2

Jarid2

Rabbit

Protein Jumonji

NM_021878

NASSSCQSTPRKGKTHKHVHNGHVFNGSSRSAREKEPAHKHRSKEATPGK