Kallikrein-5, Mouse (271a.a, HEK293, His)

The Kallikrein-5 protein may be involved in desquamation, suggesting a role in the process of skin shedding and exfoliation. Its association with desquamation suggests that it plays a role in regulating the removal of dead skin cells, which is critical for skin homeostasis. Kallikrein-5 Protein, Mouse (271a.a, HEK293, His) is the recombinant mouse-derived Kallikrein-5 protein, expressed by HEK293 , with C-His labeled tag.

Kallikrein-5 Protein, Mouse (271a.a, HEK293, His), Mouse, HEK293

12352202

95.00

VSEPVLAGDVSSCDNPSGTEPSGTNRDLSTDSKSGEDTRSDSSSRIVNGSDCQKDAQPWQGALLLGPNKLYCGAVLISPQWLLTAAHCRKPVFRIRLGHHSMSPVYESGQQMFQGIKSIPHPGYSHPGHSNDLMLIKMNRKIRDSHSVKPVEIACDCATEGTRCMVSGWGTTSSSHNNFPKVLQCLNITVLSEERCKNSYPGQIDKTMFCAGDEEGRDSCQGDSGGPVVCNGKLQGLVSWGDFPCAQRNRPGVYTNLCEFVKWIKDTMNSN

68668 (Gene_ID) Q9D140 (V23-N293) (Accession)

Approximately 35-50 kDa due to the glycosylation.

Dry ice.

Stored at -80°C for 1 year

Recombinant Proteins