KCND3 Antilichaam - middengebied: FITC (ARP35467 P050-FITC)

Potassium voltage-gated channel, Shal-related subfamily, member 3

KV4.3, SCA19, SCA22, BRGDA9, KCND3L, KCND3S, KSHIVB

3752

Q14D71

NP_751948

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit

The immunogen is a synthetic peptide directed towards the middle region of human KCND3

Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog (s) . KCND3 encodes a member of the potassium channel, voltage-gated, shal-related subfamily, members of which form voltage-activated A-type potassium ion channels and are prominent in the repolarization phase of the action potential. Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog (s) . This gene encodes a member of the potassium channel, voltage-gated, shal-related subfamily, members of which form voltage-activated A-type potassium ion channels and are prominent in the repolarization phase of the action potential. This member includes two isoforms with different sizes, which are encoded by alternatively spliced transcript variants of this gene.

NDUFS2; NAP1L1; LBR; HSPA8; HSPA5; HNRNPF; XRCC6; EWSR1; EMD; DDB1; CUX1; CDK1; AUP1; NONO; XRCC5; UQCRC2; TUBB2A; RCN2; Rapgef5; Rapgef4; Kcnip1; Rapgef3; Kcnip2; DPP10; PYCR2; VPS4A; TUBA1B; G3BP1; RUVBL1; CNBP; SRC; KCND3

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 100%; Dog: 92%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

71kDa

Potapova, I.A., (2007) FEBS J. 274 (17), 4375-4384

Wet Ice

636

KCND3

KCND3

Rabbit

Potassium voltage-gated channel, Shal-related subfamily, member 3 EMBL AAI13478.1

NM_172198

VAKTGSSNAYLHSKRNGLLNEALELTGTPEEEHMGKTTSLIESQHHHLLH