Kcnj3 Antilichaam - C-terminal regio : FITC (ARP35081 P050-FITC)

Potassium inwardly-rectifying channel, subfamily J, member 3

GIR, Kcnf, Kir3, GIRK1, Kcnf3, Kcnj1, GIRK-1, Kir3.1

16519

P63250

NP_032452

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit

This potassium channel is controlled by G proteins. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. This receptor plays a crucial role in regulating the heartbeat.

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

56kDa

Wet Ice

501

KCNJ3

Kcnj3

Rabbit

G protein-activated inward rectifier potassium channel 1

NM_008426

QEEMLLMSSPLIAPAITNSKERHNSVECLDGLDDISTKLPSKLQKITGRE