KCNK1 Konijn pAb (APR19446N)

This gene encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The product of this gene has not been shown to be a functional channel, however, it may require other non-pore-forming proteins for activity.

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality KCNK1 Rabbit pAb (APR19446N) .

KCNK1; DPK; HOHO; K2P1; K2p1.1; KCNO1; TWIK-1; TWIK1

3775

O00180

Apical cell membrane, Cell junction, Cell membrane, Cell projection, Cytoplasmic vesicle, Multi-pass membrane protein, Perikaryon, Recycling endosome, dendrite, synapse

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Liquid

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Calculated MW: 38kDa Observed MW: 38kDa

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3775

https://www.uniprot.org/uniprot/O00180

FCELHELKKFRKMFYVKKDKDEDQVHIIEHDQLSFSSITDQAAGMKEDQKQNEPFVATQSSACVDGPANH