KCNMB4 Antilichaam - middengebied: Biotine (ARP35241_P050-Biotine)

Potassium large conductance calcium-activated channel, subfamily M, beta member 4

27345

Q86W47

NP_055320

Human, Mouse, Rat, Cow, Guinea Pig, Rabbit, Sheep

The immunogen is a synthetic peptide directed towards the middle region of human KCNMB4

KCNMB4 is the regulatory subunit of the calcium activated potassium KCNMA1 (maxiK) channel. KCNMB4 modulates the calcium sensitivity and gating kinetics of KCNMA1, thereby contributing to KCNMA1 channel diversity. KCNMB4 decreases the gating kinetics and calcium sensitivity of the KCNMA1 channel, but with fast deactivation kinetics. KCNMB4 may decrease KCNMA1 channel openings at low calcium concentrations but increases channel openings at high calcium concentrations. KCNMB4 makes KCNMA1 channel resistant to 100 nM charybdotoxin (CTX) toxin concentrations.MaxiK channels are large conductance, voltage and calcium-sensitive potassium channels which are fundamental to the control of smooth muscle tone and neuronal excitability. MaxiK channels can be formed by 2 subunits: the pore-forming alpha subunit and the modulatory beta subunit. The protein encoded by this gene is an auxiliary beta subunit which slows activation kinetics, leads to steeper calcium sensitivity, and shifts the voltage range of current activation to more negative potentials than does the beta 1 subunit.

Biotin

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Sheep: 100%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

24kDa

Cavalleri, G.L., (2007) Lancet Neurol 6 (11), 970-980

Wet Ice

210

KCNMB4

KCNMB4

Rabbit

Calcium-activated potassium channel subunit beta-4

NM_014505

TCGADCRGTSQYPCVQVYVNNSESNSRALLHSDEHQLLTNPKCSYIPPCK

Beta-4