KHDRBS1 Antilichaam - N-terminalgebied: FITC (ARP37130 T100-FITC)

KH domain containing, RNA binding, signal transduction associated 1

P6, Sam, p62, p68, Sam68

20218

Q60749

NP_035447

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig, Rabbit

The immunogen is a synthetic peptide directed towards the N terminal region of mouse KHDRBS1

Khdrbs1 functions as a transcriptional repressor and may link cellular signaling pathways with components of the transcriptional machinery. It shuttles between the nucleus and the cytoplasm in secondary spermatocytes, suggesting that it may promote translation of specific RNA targets during the meiotic divisions.

Rasa1; Yes1; Src; Lyn; Fyn; SH3KBP1; Cd40; Ripk1; TRAF2; Ncoa5; Rbm39; Gtf2e2; Khdrbs1; Grb2

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

WB

0.5 mg/ml

Cow: 92%; Dog: 100%; Guinea Pig: 86%; Human: 86%; Mouse: 100%; Pig: 92%; Rabbit: 86%; Rat: 100%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

49kDa

Paronetto, M.P., et al., (2006) Mol. Biol. Cell 17 (1), 14-24

Wet Ice

443

KHDRBS1

KHDRBS1

Rabbit

KH domain-containing, RNA-binding, signal transduction-associated protein 1

NM_011317

MQRRDDPASRLTRSSGRSCSKDPSGAHPSVRLTPSRPSPLPHRPRGGGGG