KIF3B Antilichaam - middelste regio : HRP (ARP33907_P050-HRP)

Kinesin family member 3B

FLA8, RP89, HH0048, KLP-11

9371

O15066

NP_004789.1

Human, Mouse, Rat, Cow, Dog, Goat, Horse, Pig, Yeast, Zebrafish

The immunogen is a synthetic peptide directed towards the middle region of mouse KIF3B

The protein encoded by this gene acts as a heterodimer with kinesin family member 3A to aid in chromosome movement during mitosis and meiosis. The encoded protein is a plus end-directed microtubule motor and can interact with the SMC3 subunit of the cohesin complex. In addition, the encoded protein may be involved in the intracellular movement of membranous organelles. This protein and kinesin family member 3A form the kinesin II subfamily of the kinesin superfamily.

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 100%; Dog: 100%; Goat: 79%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 83%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

82kDa

Wet Ice

747

KIF3B

KIF3B

Rabbit

Kinesin-like protein KIF3B

NM_004798.3

GGGEEEEEEGEEGEEDGDDKDDYWREQQEKLEIEKRAIVEDHSLVAEEKM