
KIR2D4 Rabbit pAb (APR19447N)
Kwaliteit
ISO Gecertificeerd
Levering
24-48 uur
Technische Specificaties
Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells. The KIR genes are polymorphic and highly homologous and they are found in a cluster on chromosome 19q13.4 within the 1 Mb leukocyte receptor complex (LRC) . The gene content of the KIR gene cluster varies among haplotypes, although several 'framework' genes are found in all haplotypes (KIR3DL3, KIR3DP1, KIR3DL4, KIR3DL2) . The KIR proteins are classified by the number of extracellular immunoglobulin domains (2D or 3D) and by whether they have a long (L) or short (S) cytoplasmic domain. KIR proteins with the long cytoplasmic domain transduce inhibitory signals upon ligand binding via an immune tyrosine-based inhibitory motif (ITIM), while KIR proteins with the short cytoplasmic domain lack the ITIM motif and instead associate with the TYRO protein tyrosine kinase binding protein to transduce activating signals. The ligands for several KIR proteins are subsets of HLA class I molecules; thus, KIR proteins are thought to play an important role in regulation of the immune response. This gene is one of the 'framework' loci that is present on all haplotypes. Alternate alleles of this gene are represented on multiple alternate reference loci (ALT_REF_LOCs) . Alternative splicing results in multiple transcript variants, some of which may not be annotated on the primary reference assembly.
We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality KIR2DL4 Rabbit pAb (APR19447N) .
KIR2DL4; CD158D; G9P; KIR-103AS; KIR-2DL4; KIR103; KIR103AS
3805
Q99706
Cell membrane, Single-pass type I membrane protein
WB 1:500 - 1:2000
Liquid
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Calculated MW: 24kDa/33kDa/35kDa/37kDa/39kDa/41kDa Observed MW: 39kDa/41kDa
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3805
https://www.uniprot.org/uniprot/Q99706
WAHVGGQDKPFCSAWPSAVVPQGGHVTLRCHYRRGFNIFTLYKKDGVPVPELYNRIFWNSFLISPVTPAHAGTYRCRGFHPHSPTEWSAPSNPLVIMVTGLYEKPSLTARPGPTVRAGENVTLSCSSQSSFDIYHLSREGEAHELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYEWSDPSDPLPVSVTGNPSSSWPSPTEPSFKTGIARHLH
Beschrijving
KIR2D4 Rabbit pAb (APR19447N) Beschikbaar in 50 µL. Bestel eenvoudig online met snelle levering.
Specificaties
Recent bekeken producten

Rat IgG Lyophilized
B2013903
25 mg

Fluorescent Nanodiamond in DI water, < 1ppm NV
NDNV20nmMd10ml
10 mL

Fluorescent Nanodiamond in DI water, ~3ppm NV
NDNV70nmHi10ml
10 mL

Ligation Buffer
LB001
1.4 mL

BioCoupler® x 12
BC12
12 Each

Recombinant Common timothy PHLPIV/Phl p 4 Protein, N-His
YZZ03001
100 μg

NP (4-hydroxy-3-nitrophenylacetate)
NP-BSA-03Low – 10 mg
10 mg

NP (4-hydroxy-3-nitrophenylacetate)
NP-BSA-03High – 10 mg
10 mg
Recent gezochte producten

NIT2 Human qPCR Primer Pair (NM_020202)
HP213556
200 Reactions

NIT2 (NM_020202) Human Tagged ORF Clone
RC210660
10 µg

Human NIT2 (NM_020202) AAV Particle
RC210660A1V
250 µL

NIT2 (NM_020202) Human Tagged ORF Clone
RG210660
10 µg

NIT2 (NM_020202) Human Untagged Clone
SC108295
10 µg

NIT2 (NM_020202) Human 3' UTR Clone
SC204925
10 µg

LHX9 (NM_020204) Human 3' UTR Clone
SC210775
10 µg

Anti-h ST2 10202 SPTN-5
MBS5680565-01
1 mg
