[KO Gevalideerd] Bax Rabbit pAb (APR18716N)

The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein forms a heterodimer with BCL2, and functions as an apoptotic activator. This protein is reported to interact with, and increase the opening of, the mitochondrial voltage-dependent anion channel (VDAC), which leads to the loss in membrane potential and the release of cytochrome c. The expression of this gene is regulated by the tumor suppressor P53 and has been shown to be involved in P53-mediated apoptosis. Multiple alternatively spliced transcript variants, which encode different isoforms, have been reported for this gene.

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] Bax Rabbit pAb (APR18716N) .

BCL2L4; BAX

581

Q07812

Cytoplasm, Cytoplasm, Mitochondrion membrane, Single-pass membrane protein

IF (Human fibrosarcoma cell line, Homo sapiens) WB (Mouse embryonal fibroblast cell, Human fibrosarcoma cells, rat cells, BEL-7402, HUVEC-P6, Mus musculus, Homo sapiens, Rattus norvegicus, Gallus gallus, Bos taurus) IHC (Mus musculus) Co-IP (Mus musculus)

WB 1:500 - 1:2000 IHC 1:100 - 1:200 IF 1:50 - 1:200 IP 1:50 - 1:200

Liquid

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Calculated MW: 4kDa/12kDa/15kDa/18kDa/19kDa/21kDa/24kDa Observed MW: 21KDa

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=581

https://www.uniprot.org/uniprot/Q07812

MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMF