[KO Gevalideerd] Caspase-3 Konijn pAb (APR24674N)

This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. This protein cleaves and activates caspases 6, 7 and 9, and the protein itself is processed by caspases 8, 9 and 10. It is the predominant caspase involved in the cleavage of amyloid-beta 4A precursor protein, which is associated with neuronal death in Alzheimer's disease. Alternative splicing of this gene results in two transcript variants that encode the same protein.

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] Caspase-3 Rabbit pAb (APR24674N) .

CPP32; CPP32B; SCA-1; Active Caspase 3; CASP3; active Caspase-3; Caspase 3; Caspase-3 p12; caspase-3

836

P42574

Cytoplasm

WB (HeLa, Human uterine stromal cells, B6, NMuMG, Mus musculus, Homo sapiens, Ctenopharyngodon idellus, quails, Rattus norvegicus, lamprey, Bos taurus, Panax notoginseng (Burk.) F. H. Chen ex C. Chow, Gallus gallus, Spodoptera frugiperda, Sus scrofa) IHC (Mouse kidney, Rat brain, Mus musculus, Rattus norvegicus, Danio rerio, Actinopterygii) FC (Mus musculus) Co-IP (Mus musculus)

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Liquid

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Calculated MW: 31kDa Observed MW: 32KDa

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=836

https://www.uniprot.org/uniprot/P42574

FHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFII