[KO Gevalideerd] CD133 Rabbit pAb (APR19334N)

This gene encodes a pentaspan transmembrane glycoprotein. The protein localizes to membrane protrusions and is often expressed on adult stem cells, where it is thought to function in maintaining stem cell properties by suppressing differentiation. Mutations in this gene have been shown to result in retinitis pigmentosa and Stargardt disease. Expression of this gene is also associated with several types of cancer. This gene is expressed from at least five alternative promoters that are expressed in a tissue-dependent manner. Multiple transcript variants encoding different isoforms have been found for this gene.

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] CD133 Rabbit pAb (APR19334N) .

PROM1; AC133; CD133; CORD12; MCDR2; MSTP061; PROML1; RP41; STGD4

8842

O43490

Apical cell membrane, Cell projection, Endoplasmic reticulum, Endoplasmic reticulum-Golgi intermediate compartment, Multi-pass membrane protein, cilium, microvillus membrane, photoreceptor outer segment

WB (Mouse Monocyte Macrophage Leukemia Cells, Mus musculus) IF (Homo sapiens)

WB 1:1000 - 1:3000 IF 1:50 - 1:200 IP 1:50 - 1:200

Liquid

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Calculated MW: 92kDa/93kDa/94kDa/96kDa/97kDa Observed MW: 120KDa

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=8842

https://www.uniprot.org/uniprot/O43490

FEHYLQWIEFSISEKVASCKPVATALDTAVDVFLCSYIIDPLNLFWFGIGKATVFLLPALIFAVKLAKYYRRMDSEDVYDDVETIPMKNMENGNNGYHKDH