![[KO Gevalideerd] Prion Protein Rabbit pAb (APR29603N)](/_ipx/q_80/productPlaceholder.webp)
[KO Gevalideerd] Prion Protein Rabbit pAb (APR29603N)
Kwaliteit
ISO Gecertificeerd
Levering
24-48 uur
Technische Specificaties
The protein encoded by this gene is a membrane glycosylphosphatidylinositol-anchored glycoprotein that tends to aggregate into rod-like structures. The encoded protein contains a highly unstable region of five tandem octapeptide repeats. This gene is found on chromosome 20, approximately 20 kbp upstream of a gene which encodes a biochemically and structurally similar protein to the one encoded by this gene. Mutations in the repeat region as well as elsewhere in this gene have been associated with Creutzfeldt-Jakob disease, fatal familial insomnia, Gerstmann-Straussler disease, Huntington disease-like 1, and kuru. An overlapping open reading frame has been found for this gene that encodes a smaller, structurally unrelated protein, AltPrp. Alternative splicing results in multiple transcript variants.
We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] Prion Protein Rabbit pAb (APR24178N8) .
PRNP; ASCR; AltPrP; CD230; CJD; GSS; KURU; PRIP; PrP; PrP27-30; PrP33-35C; PrPc; p27-30
5621
P04156
Cell membrane, Cytoplasm, GPI-anchor, Golgi apparatus, Lipid-anchor, Nucleus
WB 1:500 - 1:2000 IHC 1:50 - 1:200
Liquid
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Calculated MW: 8kDa/26kDa/27kDa Observed MW: 30kDa
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5621
https://www.uniprot.org/uniprot/P04156
KKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYERESQAYYQRGS
Beschrijving
[KO Gevalideerd] Prion Protein Rabbit pAb (APR29603N) Beschikbaar in 50 µL. Bestel eenvoudig online met snelle levering.
Specificaties
Recent bekeken producten

Denhardt's Solution (50X)
EC-915
50 mL

FKBP4, ID (FK506-binding Protein 4, Peptidyl-prolyl cis-trans Isomerase FKBP4, PPIase FKBP4, Rotamase, HSP-binding Immunophilin, HBI, FKBP52 Protein, 52kD FK506-binding Protein, 52kD FKBP, FKBP-52, 59kD Immunophilin, FKBP59, p59 Protein, FKBP-4, FKBP52)
MBS623609-01
0.2 mL

West Nile Virus, NS3 Protease (WNV)
MBS603723-01
0.1 mg

Human Sertoli Cell Complete Medium
MBS2576755-01
100 mL

Urobilinogen protein
MBS5303823-01
100 mg

AffiniPure Goat Anti-Rabbit IgG H&L, HRP conjugated
GTR17765564-01
100 µL

Pribolab® Automatic Immunoaffinity Column Purification System
HWEQ-IM 5050
1 Unit

OneTaq Hot Start 2X Master Mix with GC Buffer
NEB M0485L
500 Reactions
Recent gezochte producten

FKBP4, ID (FK506-binding Protein 4, Peptidyl-prolyl cis-trans Isomerase FKBP4, PPIase FKBP4, Rotamase, HSP-binding Immunophilin, HBI, FKBP52 Protein, 52kD FK506-binding Protein, 52kD FKBP, FKBP-52, 59kD Immunophilin, FKBP59, p59 Protein, FKBP-4, FKBP52)
MBS623609-01
0.2 mL

VDAC3 (Voltage-dependent Anion-selective Channel Protein 3, VDAC-3, hVDAC3, Outer Mitochondrial Membrane Protein Porin 3) (MaxLight 750)
MBS6236090-01
0.1 mL

Vascular Endothelial Growth Factor A (VEGFA, VEGF-A, VEGF, Vascular Permeability Factor, VPF, MVCD1) (MaxLight 750)
MBS6236092-01
0.1 mL

Vascular Endothelial Growth Factor B (VEGFB, VEGF-B, VEGF-related Factor, VRF, VEGFL) (MaxLight 750)
MBS6236093-01
0.1 mL

VGFR3 (FLT4, VEGFR3, Vascular endothelial growth factor receptor 3, Fms-like tyrosine kinase 4, Tyrosine-protein kinase receptor FLT4) (MaxLight 750)
MBS6236094-01
0.1 mL

VGLL1 (Transcription Cofactor Vestigial-like Protein 1, VGL1, Vgl-1, Protein TONDU, TDU) (MaxLight 750)
MBS6236095-01
0.1 mL

VHL (Von Hippel-Lindau Disease Tumor Suppressor, pVHL, Protein G7, HRCA1, RCA1, VHL1) (MaxLight 750)
MBS6236096-01
0.1 mL

Villin-1 (VIL1, VIL, D2S1471) (MaxLight 750)
MBS6236097-01
0.1 mL
