KRT10 Antilichaam - N-terminalgebied: FITC (ARP41730_P050-FITC)

Keratin 10

BIE, EHK, K10, KPP, BCIE, CK10

3858

P13645

NP_000412

Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit

The immunogen is a synthetic peptide directed towards the N terminal region of human KRT10

KRT10 is a member of the type I (acidic) cytokeratin family, which belongs to the superfamily of intermediate filament (IF) proteins. Keratins are heteropolymeric structural proteins which form the intermediate filament. These filaments, along with actin microfilaments and microtubules, compose the cytoskeleton of epithelial cells. Mutations in the gene encoding KRT10 are associated with epidermolytic hyperkeratosis. This gene encodes a member of the type I (acidic) cytokeratin family, which belongs to the superfamily of intermediate filament (IF) proteins. Keratins are heteropolymeric structural proteins which form the intermediate filament. These filaments, along with actin microfilaments and microtubules, compose the cytoskeleton of epithelial cells. Mutations in this gene are associated with epidermolytic hyperkeratosis. This gene is located within a cluster of keratin family members on chromosome 17q21. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

UBC; Fbxl16; ADRB2; PAN2; Nphp4; Iqcb1; Cep290; Nphp1; Invs; VCAM1; SRC; ITGA4; FN1; ALB; MAGOH; TRAF3IP1; EIF4A3; AHNAK2; KRT2; KRT1; ELAVL1; UBASH3B; SHC1; PIK3R2; INPPL1; GRB2; EPS15; CRK; AP2M1; CBL; NEDD8; CAND1; DCUN1D1; COPS5; COPS6; CUL1; CUL2; CU

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 93%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 86%; Rabbit: 100%; Rat: 100%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

59kDa

Tsubota, A., (2008) J. Invest. Dermatol. 128 (7), 1648-1652

Wet Ice

584

KRT10

KRT10

Rabbit

Keratin, type I cytoskeletal 10

NM_000421

EKVTMQNLNDRLASYLDKVRALEESNYELEGKIKEWYEKHGNSHQGEPRD