KRT13 Antilichaam - C-terminalgebied: FITC (ARP42031 T100-FITC)

Keratin 13

K13, CK13, WSN2

3860

P13646

NP_002265

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish

The immunogen is a synthetic peptide directed towards the C terminal region of human KRT13

KRT13 is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. This type I cytokeratin is paired with keratin 4 and expressed in the suprabasal layers of non-cornified stratified epithelia.The protein encoded by this gene is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. This type I cytokeratin is paired with keratin 4 and expressed in the suprabasal layers of non-cornified stratified epithelia. Mutations in this gene and keratin 4 have been associated with the autosomal dominant disorder White Sponge Nevus. The type I cytokeratins are clustered in a region of chromosome 17q21.2. Alternative splicing of this gene results in multiple transcript variants; however, not all variants have been described.

FAM127C; GOLGA8EP; KRT79; TRIM42; KRT6C; CEP57L1; TXLNA; PPP1R18; ALS2CR11; KLC3; C1orf216; CCDC101; KRT71; IFT20; KLC4; FBF1; ANKRD36BP1; LSM2; EXOSC5; C1orf109; CCHCR1; KRT20; AMOTL2; ABI3; BLOC1S6; FARS2; ABI2; CEP57; EIF4E2; TSG101; TMSB4X; PSMB2; PSM

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

IHC, WB

0.5 mg/ml

Cow: 100%; Dog: 100%; Guinea Pig: 83%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 92%; Zebrafish: 85%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

46kDa

Olson, G.E., (2002) Biol. Reprod. 66 (4), 1006-1015

Wet Ice

420

KRT13

KRT13

Rabbit

Keratin, type I cytoskeletal 13

NM_002274

EAQLSELRSEMECQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKKRQPP