LBX1 Antilichaam - middengebied: FITC (ARP32808_P050-FITC)

Ladybird homeobox 1

HPX6, HPX-6, LBX1H, homeobox

10660

P52954

NP_006553

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

The immunogen is a synthetic peptide directed towards the middle region of human LBX1

LBX1 is the transcription factor required for the development of GABAergic interneurons in the dorsal horn of the spinal cord and migration and further development of hypaxial muscle precursor cells for limb muscles, diaphragm and hypoglossal cord.This gene and the orthologous mouse gene were found by their homology to the Drosophila lady bird early and late homeobox genes. In the mouse, this gene is a key regulator of muscle precursor cell migration and is required for the acquisition of dorsal identities of forelimb muscles.

RBL2

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

WB

Affinity Purified

LBX1 is supported by BioGPS gene expression data to be expressed in NCIH226

0.5 mg/ml

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

30kDa

Deloukas, P., (2004) Nature 429 (6990), 375-381

Wet Ice

281

LBX1

LBX1

Rabbit

Transcription factor LBX1

NM_006562

LPLAGRALLSQTSPLCALEELASKTFKGLEVSVLQAAEGRDGMTIFGQRQ