Ldlrap1 Antilichaam - C-terminaal gebied: Biotine (ARP55309 P050-Biotine)

A, Ar, Arh, ARH2, Arh1, FHCB1, FHCB2, AA691260

100017

NP_663529

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Ldlrap1

Ldlrap1 is an adapter protein (clathrin-associated sorting protein (CLASP) ) required for efficient endocytosis of the LDL receptor (LDLR) in polarized cells such as hepatocytes and lymphocytes, but not in non-polarized cells (fibroblasts) . It may be required for LDL binding and internalization but not for receptor clustering in coated pits. It may facilitate the endocytocis of LDLR and LDLR-LDL complexes from coated pits by stabilizing the interaction between the receptor and the structural components of the pits. Ldlrap1 may also be involved in the internalization of other LDLR family members. Ldlrap1 binds to phosphoinositides, which regulate clathrin bud assembly at the cell surface.

Foxp3; Lrp1

Biotin

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

29kDa

Wet Ice

264

LDLRAP1

Ldlrap1

Rabbit

NM_145554

APLSTVSANTNNVDETPRPQVLGNNSVVWELDDGLDEAFSRLAQSRTNPQ