LGR4, mens (HEK293, zijn)

The Lgr4/GPR48 protein is a receptor for R-spondins that activates the canonical Wnt pathway and is critical for organ development (liver, kidney, intestine, bone, reproductive tract, and eye) . Lgr4/GPR48 binds R-spondins (RSPO1-4), binds to phosphorylated LRP6 and Frizzled receptors, and initiates Wnt signaling without activating G proteins. Lgr4/GPR48 Protein, Human (HEK293, His) is the recombinant human-derived Lgr4/GPR48 protein, expressed by HEK293, with C-His labeled tag.

Lgr4/GPR48 Protein, Human (HEK293, His), Human, HEK293

12352202

85

APPLCAAPCSCDGDRRVDCSGKGLTAVPEGLSAFTQALDISMNNITQLPEDAFKNFPFLEELQLAGNDLSFIHPKALSGLKELKVLTLQNNQLKTVPSEAIRGLSALQSLRLDANHITSVPEDSFEGLVQLRHLWLDDNSLTEVPVHPLSNLPTLQALTLALNKISSIPDFAFTNLSSLVVLHLHNNKIRSLSQHCFDGLDNLETLDLNYNNLGEFPQAIKALPSLKELGFHSNSISVIPDGAFDGNPLLRTIHLYDNPLSFVGNSAFHNLSDLHSLVIRGASMVQQFPNLTGTVHLESLTLTGTKISSIPNNLCQEQKMLRTLDLSYNNIRDLPSFNGCHALEEISLQRNQIYQIKEGTFQGLISLRILDLSRNLIHEIHSRAFATLGPITNLDVSFNELTSFPTEGLNGLNQLKLVGNFKLKEALAAKDFVNLRSLSVPYAYQCCAFWGCDSYANLNTEDNSLQDHSVAQEKGTADAANVTSTLENEEHSQIIIHCTPSTGAFKPCEYLLGSWMIRLT

55366 (Gene_ID) Q9BXB1-1 (A25-T544) (Accession)

Approximately 70-100 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Room temperature in continental US; may vary elsewhere.

Stored at -20°C for 2 years

Recombinant Proteins