LLGL2 Konijn pAb (APR19914N)

The lethal (2) giant larvae protein of Drosophila plays a role in asymmetric cell division, epithelial cell polarity, and cell migration. This human gene encodes a protein similar to lethal (2) giant larvae of Drosophila. In fly, the protein's ability to localize cell fate determinants is regulated by the atypical protein kinase C (aPKC) . In human, this protein interacts with aPKC-containing complexes and is cortically localized in mitotic cells. Alternative splicing results in multiple transcript variants encoding different isoforms.

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality LLGL2 Rabbit pAb (APR19914N) .

LLGL2; HGL; Hugl-2; LGL2

217325

Cytoplasm

WB 1:500 - 1:2000 IHC 1:50 - 1:100

Liquid

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Calculated MW: 114kDa Observed MW: 114kDa

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=217325

IASCVFTKYGQGFYLISPSEFERFSLSTKWLVEPRCLVDSTKAKKHNRPSNGNGTGLKMTSSGHVRNSKSQSDGDEKKPGPVMEHALLNDAWVLKEIQSTL