MAGEA1 Antilichaam - C-terminalgebied: FITC (ARP46116_T100-FITC)

Melanoma antigen family A, 1 (directs expression of antigen MZ2-E)

CT1.1, MAGE1

4100

P43355

NP_004979

Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit

The immunogen is a synthetic peptide directed towards the C terminal region of human MAGEA1

The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita.This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

CEP57L1; ZNF564; RAB17; C19orf66; MIEF1; HYPK; TRIM31; SELPLG; PBX3; SFN; DNM1L; Nsmce2; Nsmce1; Pias1; Cbx4; EID3; EID2; EID2B; NSMCE4A; EID1; UBC; SGK1; SNW1; HDAC1; SH3GLB2; UQCRB; HLA-B; HLA-A

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

WB

0.5 mg/ml

Cow: 79%; Dog: 79%; Horse: 100%; Human: 100%; Mouse: 77%; Pig: 79%; Rabbit: 86%; Rat: 83%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

34kDa

Ries, J., (2008) J. Oral Pathol. Med. 37 (2), 88-93

Wet Ice

309

MAGEA1

MAGEA1

Rabbit

Melanoma-associated antigen 1

NM_004988

MIAMEGGHAPEEEIWEELSVMEVYDGREHSAYGEPRKLLTQDLVQEKYLE