Mapk1 Antilichaam - C-terminal regio : HRP (ARP61143 P050-HRP)

Mitogen-activated protein kinase 1

ERK, MAP, Prk, Erk2, p42m, MAPK2, PRKM2, Prkm1, C78273, p41mapk, p42mapk, AA407128, AU018647, 9030612K14Rik

26413

P63085

NP_036079

Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit, Zebrafish

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Mapk1

Mapk1 is a serine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway.

Nos-3; Mapk6; Mapk3; Eed; Atf2; BCL2L1; Metap2; Pxn; Mbp; Fert2; Crk; Vrk3; Dusp3; Elk1; Eif4ebp2; Eif4ebp1; Dusp2; Capn2; Sqstm1; Stat1; Itgb5; Mdk; vif; Grin2b; Grin1; Cttn; Pea15b; Pea15a; Blnk; Pcyt1a; Top2a; TP53; KLF11; Sos1; Irx2; Dync1i1; Rps6ka3

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 100%; Dog: 93%; Goat: 100%; Guinea Pig: 93%; Horse: 93%; Human: 93%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 100%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

41kDa

Wet Ice

358

MAPK1

Mapk1

Rabbit

Mitogen-activated protein kinase 1

NM_011949

EVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETA