MDM1 Antilichaam - N-terminalgebied: HRP (ARP49471 P050-HRP)

Mdm1 nuclear protein homolog (mouse)

56890

B2RB22

NP_064513

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

The immunogen is a synthetic peptide directed towards the N terminal region of human MDM1

MDM1 is a nuclear protein similar to the mouse double minute 1 protein. The mouse gene is located in double minute (DM) chromatin particles and is amplified in the mouse transformed 3T3 cell line, and the protein is able to bind to p53. This gene encodes a nuclear protein similar to the mouse double minute 1 protein. The mouse gene is located in double minute (DM) chromatin particles and is amplified in the mouse transformed 3T3 cell line, and the protein is able to bind to p53. In mouse several transcripts have been described for this gene which result from alternative polyadenylation, splicing and exon usage.

HDAC8

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

MDM1 is supported by BioGPS gene expression data to be expressed in Jurkat

0.5 mg/ml

Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

25kDa

Oh, J.H., (2005) Mamm. Genome 16 (12), 942-954

Wet Ice

222

MDM1

MDM1

Rabbit

CDNA, FLJ95264, highly similar to Homo sapiens Mdm4, transformed 3T3 cell double minute 1, p53 binding protein (mouse) (MDM1), transcript variant 2, mRNA EMBL BAG37069.1

NM_020128

GLRSDQLGITKEPSFISKRRVPYHDPQISKSLEWNGAISESNVVASPEPE