MED18 Antilichaam: FITC (ARP62134 P050-FITC)

Mediator complex subunit 18

SRB5, p28b

54797

Q9BUE0

NP_060108

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

The immunogen is a synthetic peptide directed towards the following sequence KIMVYKIFRILVPGNTDSTEALSLSYLVELSVVAPAGQDMVSDDMKNFAE

MED18 is a component of the Mediator complex, which is a coactivator for DNA-binding factors that activate transcription via RNA polymerase II (Sato et al., 2003 [PubMed 12584197]) .[supplied by OMIM, Oct 2008]

HOMEZ; TRIM39; MED20; CAMK2B; UBC; CDK19; CDK8; MED19; MED26; EPAS1; MED11; MED8; MED4; MED16; MED24; MED21; MED14; PIP4K2B; MED1; MED30; MED10; MED28; MED29; MED18; MED15; MED31; MED6; MED13; MED12; MED27; MED17; MED23; TADA2A; MED22; CCNC; MED9; USP49

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

Affinity Purified

0.5 mg/ml

Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 86%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

24 kDa

Wet Ice

208

MED18

MED18

Rabbit

Mediator of RNA polymerase II transcription subunit 18

NM_001127350

KIMVYKIFRILVPGNTDSTEALSLSYLVELSVVAPAGQDMVSDDMKNFAE