MED21 Antilichaam - middengebied: HRP (ARP37735_P050-HRP)

Mediator complex subunit 21

SRB7, SURB7, hSrb7

9412

Q13503

NP_004255

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish

The immunogen is a synthetic peptide directed towards the middle region of human MED21

MED21 belongs to the Mediator complex subunit 21 family. It is the component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.

MAGEB4; SSC5D; ZNF655; BLOC1S6; MED21; CDK8; MED19; MED26; UBC; HTT; FBXW7; MED11; MED8; MED28; MED29; MED18; MED4; MED16; MED6; MED13; MED12; MED24; MED17; MED14; MED22; MED1; ELAVL1; VAV2; SKP1; THRA; THRB; MED10; TP53; SREBF1; ZC3H13; ZSCAN1; PCBD2; TA

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

15kDa

Andersen, J.S., (2005) Nature 433 (7021), 77-83

Wet Ice

144

MED21

MED21

Rabbit

Mediator of RNA polymerase II transcription subunit 21

NM_004264

DSLPSEESTAALQAASLYKLEEENHEAATCLEDVVYRGDMLLEKIQSALA

21