MED26 Antilichaam - N-terminaal gebied: Biotine (ARP38518_P050-Biotine)

Mediator complex subunit 26

CRSP7, CRSP70

9441

O95402

NP_004822

Human, Mouse, Rat, Cow, Dog, Rabbit

The immunogen is a synthetic peptide directed towards the N terminal region of human MED26

MED26 is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor- (TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors.The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor- (TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-261 AC024075.4 20290-20550 c 262-726 AF104253.1 1-465 727-3184 AK128435.1 1414-3871

MED19; MED13; MED12; MED21; MED11; TAF8; MED8; MED30; EAF1; MED10; TAF3; MED25; MED28; ICE2; EAF2; MED29; MED9; MED18; MED15; MED31; MED4; AFF4; MED13L; ICE1; CDK19; ELL2; MED16; MED6; MED20; MED7; MED27; MED17; MED23; MED14; ELL; TAF15; TCEB3; TCEA1; TBP

Biotin

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 93%; Dog: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

65kDa

Olsen, J.V., (2006) Cell 127 (3), 635-648

Wet Ice

600

MED26

MED26

Rabbit

Mediator of RNA polymerase II transcription subunit 26

NM_004831

TAAPASPQQIRDRLLQAIDPQSNIRNMVAVLEVISSLEKYPITKEALEET

26