METAP1D/Methionine aminopeptidase 1D, menselijk (sf9, zijn)

METAP1D or methionine aminopeptidase 1D plays a crucial role in protein maturation, catalyzing the removal of N-terminal methionine from nascent proteins. Its activity is prominent in the smaller, uncharged second residue (Met-Ala, Cys, Gly, Pro, Ser, Thr or Val) . METAP1D/Methionine aminopeptidase 1D Protein, Human (sf9, His) is the recombinant human-derived METAP1D/Methionine aminopeptidase 1D protein, expressed by Sf9 insect cells , with C-His labeled tag.

METAP1D/Methionine aminopeptidase 1D Protein, Human (sf9, His), Human, Sf9 insect cells

12352202

RQRDISHSIVLPAAVSSAHPVPKHIKKPDYVTTGIVPDWGDSIEVKNEDQIQGLHQACQLARHVLLLAGKSLKVDMTTEEIDALVHREIISHNAYPSPLGYGGFPKSVCTSVNNVLCHGIPDSRPLQDGDIINIDVTVYYNGYHGDTSETFLVGNVDECGKKLVEVARRCRDEAIAACRAGAPFSVIGNTISHITHQNGFQVCPHFVGHGIGSYFHGHPEIWHHANDSDLPMEEGMAFTIEPIITEGSPEFKVLEDAWTVVSLDNQRSAQFEHTVLITSRGAQILTKLPHEA

254042 (Gene_ID) Q6UB28/NP_954697.1 (R44-A335) (Accession)

Approximately 36 kDa, based on SDS-PAGE under reducing conditions.

Room temperature in continental US; may vary elsewhere.

Recombinant Proteins