METTL4 Rabbit pAb (APR28564N)

N (6-adenine-specific methyltransferase that can methylate both RNAs and DNA. Acts as a N (6-adenine-specific RNA methyltransferase by catalyzing formation of N6,2'-O-dimethyladenosine (m6A (m on internal positions of U2 small nuclear RNA (snRNA: methylates the 6th position of adenine residues with a pre-deposited 2'-O-methylation. Internal m6A (m methylation of snRNAs regulates RNA splicing. Also able to act as a N (6-adenine-specific DNA methyltransferase by mediating methylation of DNA on the 6th position of adenine (N (6-methyladenosine. The existence of N (6-methyladenosine (m6A on DNA is however unclear in mammals, and additional evidences are required to confirm the role of the N (6-adenine-specific DNA methyltransferase activity of METTL4 in vivo. Acts as a regulator of mitochondrial transcript levels and mitochondrial DNA (mtDNA copy number by mediating mtDNA N (6-methylation: m6A on mtDNA reduces transcription by repressing TFAM DNA-binding and bending. N (6-methyladenosine deposition by METTL4 regulates Polycomb silencing by triggering ubiquitination and degradation of sensor proteins ASXL1 and MPND, leading to inactivation of the PR-DUB complex and subsequent preservation of Polycomb silencing (By similarity.

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality METTL4 Rabbit pAb (APR28564N) .

METTL4; HsT661

64863

Q8N3J2

WB 1:1000 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Liquid

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Calculated MW: 54kDa Observed MW: 54kDa

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=64863

https://www.uniprot.org/uniprot/Q8N3J2

MSVVHQLSAGWLLDHLSFINKINYQLHQHHEPCCRKKEFTTSVHFESLQMDSVSSSGVCAAFIASDSSTKPENDDGGNYEMFTRKFVFRPELFDVTKPYITPAVHKECQQSNEKEDLMNGVKKEISISIIGKKRKRCVVFNQGELDAMEYHTKIRELILDGSLQLIQEGLKSGFLYPLFEKQDKGSKPIT