MKRN2 Antilichaam - N-terminal regio : HRP (ARP43143_P050-HRP)

Makorin ring finger protein 2

RNF62, HSPC070

23609

Q9H000

NP_054879

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish

The immunogen is a synthetic peptide directed towards the N terminal region of human MKRN2

Members of the makorin family, including MKRN2, have a characteristic zinc finger composition that suggests that they are ribonucleoproteins.Members of the makorin family, including MKRN2, have a characteristic zinc finger composition that suggests that they are ribonucleoproteins (Gray et al., 2001 [PubMed 11597136]) .[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-2778 BC015715.1 24-2801

C1orf109; UBE2D4; GNB2L1; UBE2D1; UBC; NDN; RBCK1; UBE2K

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

MKRN2 is supported by BioGPS gene expression data to be expressed in HeLa

0.5 mg/ml

Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

47kDa

Gray, T.A., (2001) Genomics 77 (3), 119-126

Wet Ice

416

MKRN2

MKRN2

Rabbit

Probable E3 ubiquitin-protein ligase makorin-2

NM_014160

STKQITCRYFMHGVCREGSQCLFSHDLANSKPSTICKYYQKGYCAYGTRC