MMP20 Antilichaam - middengebied: HRP (ARP46497 P050-HRP)

Matrix metallopeptidase 20

AI2A2, MMP-20

9313

O60882

NP_004762

Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit

The immunogen is a synthetic peptide directed towards the middle region of human MMP20

Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. MMP20 degrades amelogenin, the major protein component of dental enamel matrix, and so the protein is thought to play a role in tooth enamel formation. A mutation in the gene encoding MMP20, which alters the normal splice pattern and results in premature termination of the encoded protein, has been associated with amelogenesis imperfecta.

ACAN

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 93%; Dog: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 86%; Rat: 92%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

43kDa

Wet Ice

483

MMP20

MMP20

Rabbit

Matrix metalloproteinase-20

NM_004771

AAVYLREPQKTLFFVGDEYYSYDERKRKMEKDYPKNTEEEFSGVNGQIDA