Morf4l1 Antilichaam - middelste regio : HRP (ARP47607_P050-HRP)

Mortality factor 4 like 1

MRG1, MORFR, MRG15, Tex189, TEG-189, MORFRG15, mKIAA4002

21761

P60762

NP_001034236

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish

Morf4l1 is a component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. The NuA4 complex ATPase and helicase activities seem to be, at least in part, contributed by the association of RUVBL1 and RUVBL2 with EP400. NuA4 may also play a direct role in DNA repair when directly recruited to sites of DNA damage.

Nanog; Hdac1; Phf12; Sin3b; Rb1; MRFAP1; Vezf1; Rnf2; Kdm5b; SIN3A; TLE1; PFN2

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 93%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 85%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

41kDa

Wet Ice

362

MORF4L1

Morf4l1

Rabbit

Mortality factor 4-like protein 1

NM_001039147

LQQKNVEVKTKKNKQKTPGNGDGGSTSETPQPPRKKRARVDPTVENEETF