
MRPL24 Antilichaam - N-terminaal gebied: Biotine (ARP41010_P050-Biotine)
Kwaliteit
ISO Gecertificeerd
Levering
24-48 uur
Technische Specificaties
Mitochondrial ribosomal protein L24
L24mt, MRP-L18, MRP-L24
79590
Q96A35
NP_078816
• Rabbit
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
The immunogen is a synthetic peptide directed towards the N terminal region of human MRPL24
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. MRPL24 is a 39S subunit protein which is more than twice the size of its E.coli counterpart (EcoL24) .Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein which is more than twice the size of its E.coli counterpart (EcoL24) . Sequence analysis identified two transcript variants that encode the same protein.
TP53; AURKA; GRSF1; NPM1; MRPL21; C19orf70; MRPL45; TMEM177; MRPL44; MRPL40; MRPS5; TSR1; MRPL39; MRPL51; MRPL37; MRPL4; MRPL2; MRPL13; ERLEC1; MRPL19; TUFM; RPS15; ILF2; ABCC2; APP; CUL3; UBC; Ybx1; ICT1
• Polyclonal
Biotin
Polyclonal Antibody
WB
Affinity Purified
MRPL24 is supported by BioGPS gene expression data to be expressed in 721_B
0.5 mg/ml
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Liquid. Purified antibody supplied in 1x PBS buffer.
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
25kDa
Gregory, S.G., (2006) Nature 441 (7091), 315-321
Wet Ice
216
MRPL24
MRPL24
Rabbit
39S ribosomal protein L24, mitochondrial
NM_024540
RRRPVVVEPISDEDWYLFCGDTVEILEGKDAGKQGKVVQVIRQRNWVVVG
Beschrijving
MRPL24 Antilichaam - N-terminaal gebied: Biotine (ARP41010_P050-Biotine) Beschikbaar in 100 µL. Bestel eenvoudig online met snelle levering.
Specificaties
Recent bekeken producten

Anti- Protein A Antibody
GWB-E66F30
1 mL

Recombinant TAFV GP1 Protein, C-Fc
EVV03609
100 μg

Gabbr1 Mouse Monoclonal Antibody [Clone ID: S93A-49]
TA326530
100 µg

BSA-Myc/DDK Control Protein
AR100025
50 µL

NH-6
ABC-TC0826
1 Vial

Anti-TAT (Thrombin-antithrombin) Antibody
ABS 014-22-1
1000 µL

Anti-APOE2 mouse monoclonal antibody
TD-AB0132
100 µg

CD35 (CR1) mouse monoclonal antibody, clone J3D3, Azide Free
BM2364
0.2 mg
