MRPL24 Antilichaam - N-terminalgebied : HRP (ARP41010_P050-HRP)

Mitochondrial ribosomal protein L24

L24mt, MRP-L18, MRP-L24

79590

Q96A35

NP_078816

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit

The immunogen is a synthetic peptide directed towards the N terminal region of human MRPL24

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. MRPL24 is a 39S subunit protein which is more than twice the size of its E.coli counterpart (EcoL24) .Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein which is more than twice the size of its E.coli counterpart (EcoL24) . Sequence analysis identified two transcript variants that encode the same protein.

TP53; AURKA; GRSF1; NPM1; MRPL21; C19orf70; MRPL45; TMEM177; MRPL44; MRPL40; MRPS5; TSR1; MRPL39; MRPL51; MRPL37; MRPL4; MRPL2; MRPL13; ERLEC1; MRPL19; TUFM; RPS15; ILF2; ABCC2; APP; CUL3; UBC; Ybx1; ICT1

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

MRPL24 is supported by BioGPS gene expression data to be expressed in 721_B

0.5 mg/ml

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

25kDa

Gregory, S.G., (2006) Nature 441 (7091), 315-321

Wet Ice

216

MRPL24

MRPL24

Rabbit

39S ribosomal protein L24, mitochondrial

NM_024540

RRRPVVVEPISDEDWYLFCGDTVEILEGKDAGKQGKVVQVIRQRNWVVVG