MRPS11 Antilichaam - middengebied: Biotine (ARP62568 P050-Biotine)

Mitochondrial ribosomal protein S11

HCC-2, S11mt, MRP-S11

64963

E7EP84

NP_001139310

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that contains a high level of sequence similarity with ribosomal protein S11P family members. A pseudogene corresponding to this gene is found on chromosome 20. Sequence analysis identified two transcript variants that encode different protein isoforms.

CEP57; CEP76; SRPK1; MRPS14; SAMM50; RPL23; RPS26; RPS23; RPL9; CUL3; COPS5; UBC; ICT1

Biotin

Polyclonal Antibody

WB

Affinity Purified

MRPS11 is supported by BioGPS gene expression data to be expressed in 721_B

0.5 mg/ml

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

17kDa

Wet Ice

161

MRPS11

MRPS11

Rabbit

Mitochondrial fission regulator 1 Ensembl ENSP00000391502

NM_001145838

GTEGFRNAKKGTGIAAQTAGIAAAARAKQKGVIHIRVVVKGLGPGRLSAM