MYL6B Antilichaam - middengebied HRP (ARP52010 P050-HRP)

Myosin, light chain 6B, alkali, smooth muscle and non-muscle

MLC1SA

140465

P14649

NP_002466

Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit

The immunogen is a synthetic peptide directed towards the middle region of Human MYL6B

Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain expressed in both slow-twitch skeletal muscle and in nonmuscle tissue. Alternative splicing results in multiple transcript variants.

SPA17; HUWE1; CEP76; CEP57; UBC; RNF2; PAN2; ESR1; C11orf58; MYL6; CUL1; TCF3; SP1; IQGAP1

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity purified

0.5 mg/ml

Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 86%; Rabbit: 100%; Rat: 100%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

22kDa

Wet Ice

208

MYL6B

MYL6B

Rabbit

Myosin light chain 6B

VGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDELKSRRVDFETFL