NCAM1 / CD56 Rabbit pAb (APR27811N)

This gene encodes a cell adhesion protein which is a member of the immunoglobulin superfamily. The encoded protein is involved in cell-to-cell interactions as well as cell-matrix interactions during development and differentiation. The encoded protein has been shown to be involved in development of the nervous system, and for cells involved in the expansion of T cells and dendritic cells which play an important role in immune surveillance. Alternative splicing results in multiple transcript variants.

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NCAM1 / CD56 Rabbit pAb (APR27811N) .

CD56; MSK39; NCAM; NCAM1; NCAM1 /CD56

4684

P13591

Cell membrane, GPI-anchor, Lipid-anchor, Secreted, Single-pass type I membrane protein

WB (mouse brain, Rat hippocampus, Homo sapiens) IF (Homo sapiens) IHC (Mus musculus)

WB 1:500 - 1:2000 IHC 1:100 - 1:200 IF 1:50 - 1:200 IP 1:50 - 1:200

Liquid

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Calculated MW: 40kDa/73kDa/80kDa/83kDa/93kDa/94kDa Observed MW: 120-220KDa

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=4684

https://www.uniprot.org/uniprot/P13591

LCGKAGPGAKGKDMEEGKAAFSKDESKEPIVEVRTEEERTPNHDGGKHTEPNETTPLTEPEKGPVEAKPECQETETKPAPAEVKTVPNDATQTKENESKA