NEDD8 Konijn pAb (APR18543N)

Nedd8 is an 81 amino acid Ub-like protein. It is conjugated to protein substrates in much the same way as Ub, using the E1, E2, E3 cascade. The specific E1 used is a heterodimer of APPBP1/UBA3. Two E2s have been discovered to follow called Ubc12 and Ube2F. Neddylation causes conformational change of the Cullin protein in the E3 called cullin-RING ligases (CRLs), which enhances the E3 Ub ligase activity of CRLs.

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NEDD8 Rabbit pAb (APR18543N) .

NEDD8; NEDD-8

4738

Q15843

Nucleus

WB 1:500 - 1:2000 IHC 1:50 - 1:100

Liquid

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Calculated MW: 9kDa Observed MW: 12kDa

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=4738

https://www.uniprot.org/uniprot/Q15843

MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGGGGLRQ