Nfe2 Antilichaam - C-terminalgebied: HRP (ARP31216_P050-HRP)

Nuclear factor (erythroid-derived 2), 45kDa

P4, p45, NF-E, NF-E2, p45NF, p45nf-, p45NFE2, p45nf-e2, NF-E2/P45

18022

Q07279

NP_032711

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit

The immunogen is a synthetic peptide directed towards the C-terminal region of MOUSE Nfe2

Nfe2 is a component of the NF-E2 complex essential for regulating erythroid and megakaryocytic maturation and differentiation.It binds to the hypersensitive site 2 (HS2) of the beta-globin control region (LCR) . This subunit (NFE2) recognizes the TCAT/C sequence of the AP-1-like core palindrome present in a number of erythroid and megakaryocytic gene promoters. It requires MAFK or other small MAF proteins for binding to the NF-E2 motif. It may play a role in all aspects of hemoglobin production from globin and heme synthesis to procurement of iron.

Psmd4; Kmt2d; Rbbp5; Wdr5; Ash2l; Men1; Mafk; H3f3a; Crebbp; Mapk8; Trip4; Plrg1; Pdlim4; Zfp292; Gtf2h2; Zscan2; Ubp1; Tsg101; Tial1; Supt4a; Snai1; Kdm5d; Kdm5c; Dpf2; Per1; Kat2b; Mybbp1a; Orc2; Ikbkg; Hoxb4; Hoxa4; Hcls1; Gtf2h1; Foxn2; E4f1; Dlx5; Ci

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 86%; Dog: 93%; Guinea Pig: 93%; Horse: 79%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

41kDa

Wet Ice

373

NFE2

Nfe2

Rabbit

Transcription factor NF-E2 45 kDa subunit

NM_008685

ARGEADRTLEVMRQQLAELYHDIFQHLRDESGNSYSPEEYVLQQAADGAI