Nfkbiz Antilichaam - C-terminal regio: FITC (ARP57676 P050-FITC)

Nuclear factor of kappa light polypeptide gene enhancer in B cells inhibitor, zeta

M, INAP, Mail, AA408868

80859

Q9EST8

NP_085115

Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish

The immunogen is a synthetic peptide corresponding to a region of Mouse

Nfkbiz is involved in regulation of NF-kappa-B transcription factor complexes. It inhibits NF-kappa-B activity without affecting its nuclear translocation upon stimulation. It inhibits DNA-binding of RELA and NFKB1/p50, and of the NF-kappa-B p65-p50 heterodimer and the NF-kappa-B p50-p50 homodimer. It seems also to activate NF-kappa-B-mediated transcription. In vitro, upon association with NFKB1/p50, Nfkbiz has transcriptional activation activity and, together with NFKB1/p50 and RELA, Nfkbiz is recruited to LCN2 promoters.

Nfkb2; Nfkb1; Ikbkg; Elf5; Ehf; Il6

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 91%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

80kDa

Wet Ice

728

NFKBIZ

Nfkbiz

Rabbit

NF-kappa-B inhibitor zeta

NM_030612

VRLLMRKGADPSTRNLENEQPVHLVPDGPVGEQIRRILKGKSIQQRAPPY