NKX2-3 Antilichaam - middelste regio : HRP (ARP32191 P050-HRP)

NK2 homeobox 3

CSX3, NK2.3, NKX2C, NKX2.3, NKX4-3

159296

Q8TAU0

NP_660328

Human, Mouse, Rat, Cow, Dog, Guinea Pig

The immunogen is a synthetic peptide directed towards the middle region of human NKX2-3

NKX2C is a member of the NKX family of homeodomain-containing transcription factors, which are implicated in many aspects of cell type specification and maintenance of differentiated tissue functions.NKX2C is a member of the NKX family of homeodomain-containing transcription factors, which are implicated in many aspects of cell type specification and maintenance of differentiated tissue functions. See Harvey (1996) [PubMed 8812123] for a review of the structure, regulation, function, and evolution of NK2 homeobox genes with an emphasis on their roles in heart development.[supplied by OMIM]. Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by orthologous data and transcript alignments.

ZNF212; GTF2A1L; SRF

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 87%; Dog: 93%; Guinea Pig: 87%; Human: 100%; Mouse: 80%; Rat: 87%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

38kDa

Fisher, S.A., (2008) Nat. Genet. 40 (6), 710-712

Wet Ice

364

NKX2-3

NKX2-3

Rabbit

Homeobox protein Nkx-2.3

NM_145285

AHAPPPPPRRVAVPVLVRDGKPCVTPSAQAYGAPYSVGASAYSYNSFPAY