NKX6-3 Antilichaam - C-terminal regio : FITC (ARP34488_P050-FITC)

NK6 homeobox 3

NKX6.3

157848

A6NJ46

Human, Mouse, Rat, Rabbit

The immunogen is a synthetic peptide directed towards the C-terminal region of Human NKX6-3

Nkx6.3 is a new member of the Nkx6 subfamily of homeodomain proteins. Members of the Nkx family of homeodomain proteins are involved in a variety of developmental processes such as cell fate determination in the CNS and in the pancreas. Nkx6.3 is expressed in the developing CNS and gastro-intestinal tract. Nkx6.3 shows a remarkably selective expression in a subpopulation of differentiating V2 neurons at caudal hindbrain levels. In the gut, Nkx6.3 is expressed in duodenal and glandular stomach endoderm and at the end of gestation Nkx6.3 became restricted to the base of the gastric units in the glandular stomach.

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Human: 100%; Mouse: 83%; Rabbit: 86%; Rat: 93%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

29kDa

Wet Ice

265

NKX6-3

NKX6-3

Rabbit

Homeobox protein Nkx-6.3

ESQVKVWFQNRRTKWRKKSALEPSSSTPRAPGGAGAGAGGDRAPSENEDD