NR1I3 Antilichaam - middengebied: HRP (ARP37876_T100-HRP)

Nuclear receptor subfamily 1, group I, member 3

C, CA, mC, CAR, MB67, Care2, ESTM3, ESTM32, AA209988, AI551208, CAR-beta

12355

O35627

NP_033933

Mouse, Rat, Cow, Dog, Guinea Pig

The immunogen is a synthetic peptide directed towards the middle region of mouse NR1I3

NR1I3 mediates the induction of transcription of cytochrome P450 (CYP) genes by phenobarbital (PB) and PB-type inducers. NR1I3 activation induces hepatic expression of detoxification enzymes and transporters and increases liver size. NR1I3 can also regulate both liver homeostasis and tumorigenesis in response to xenobiotic stresses.

NCOR2; Ppp2r1a; Ppp2ca; Hsp90ab1; Psmc4; NR0B2; Ncoa1; Ncor1; Rxrg; NCOA6

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

0.5 mg/ml

Cow: 85%; Dog: 86%; Guinea Pig: 79%; Mouse: 93%; Rat: 93%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

39kDa

Briancon, N. (2006) EMBO J. 25 (6), 1253-1262

Wet Ice

358

NR1I3

NR1I3

Rabbit

Nuclear receptor subfamily 1 group I member 3

NM_009803

KELVQILLGAHTRHVGPLFDQFVQFKPPAYLFMHHRPFQPRGPVLPLLTH