Nr2c1 Antilichaam - middengebied: FITC (ARP37896_P050-FITC)

Nuclear receptor subfamily 2, group C, member 1

Ee, TR, TR2, 80.3, Eenr, Tr2-1, Tr2-11, 4831444H07Rik

22025

Q505F1-2

Human, Mouse, Rat, Dog, Horse, Rabbit

The immunogen is a synthetic peptide directed towards the middle region of MOUSE Nr2c1

Nr2c1 is an orphan nuclear receptor. Nr2c1 represses transcription and binds DNA as a homodimer. Nr2c1 binds the IR7 element in the promoter of its own gene in an autoregulatory negative feedback mechanism.

Nrip1; Nr2c1

FITC: Fluorescein Isothiocyanate

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Dog: 87%; Horse: 87%; Human: 93%; Mouse: 93%; Rabbit: 80%; Rat: 100%

Liquid. Purified antibody supplied in 1x PBS buffer.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

28kDa

Wet Ice

256

NR2C1

Nr2c1

Rabbit

Nuclear receptor subfamily 2 group C member 1

GSTPGKVFLTTPDAAGVNQLFFTSPDLSAPHLQLLTEKSPDQGPNKVFDL