NR2E3 Antilichaam - C-terminal regio : HRP (ARP39070_P050-HRP)

Nuclear receptor subfamily 2 group E member 3

PNR, RNR, rd7, ESCS, RP37

10002

Q8IVZ9

XP_011519448.1

Human, Mouse, Rat, Cow, Guinea Pig, Horse, Pig

The immunogen is a synthetic peptide directed towards the C-terminal region of human NR2E3

This protein is part of a large family of nuclear receptor transcription factors involved in signaling pathways. Nuclear receptors have been shown to regulate pathways involved in embryonic development, as well as in maintenance of proper cell function in adults. Members of this family are characterized by discrete domains that function in DNA and ligand binding. This gene encodes a retinal nuclear receptor that is a ligand-dependent transcription factor. Defects in this gene are a cause of enhanced S cone syndrome. Alternatively spliced transcript variants encoding different isoforms have been identified.

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

Affinity Purified

0.5 mg/ml

Cow: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

35kDa

Wet Ice

322

NR2E3

NR2E3

Rabbit

Photoreceptor-specific nuclear receptor

XM_011521146.1

EHVEALQDQSQVMLSQHSKAHHPSQPVRFGKLLLLLPSLRFITAERIELL