NR5A1 Antilichaam - C-terminalgebied: HRP (ARP37471 T100-HRP)

Nuclear receptor subfamily 5, group A, member 1

E, SF, Ad4, ELP, SF-, SF1, SF-1, Ad4BP, ELP-3, Ftzf1, STF-1, Ftz-F1

26423

P33242

NP_620639

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep

The immunogen is a synthetic peptide corresponding to a region of Mouse

NR5A1 is an important regulator of steroidogeneisis which is present in human skin and its appendages. It plays a role in regulating p450scc expression with TReP-132 and CBP/p300.

Pitx1; Nfya; Pin1; Sumo1; Ubc; Egr1; Mir383; Ncoa1; Sumo2; Ppargc1a; Lhb; Tbx19; Sox9; Nr0b2; Nr0b1; Ncoa2

HRP: Horseradish Peroxidase

Polyclonal Antibody

WB

0.5 mg/ml

Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 93%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93%

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

51kDa

Fatchiyah, et al., (2006) Biochem. Biophys. Res. Commun. 341 (4), 1036-1045

Wet Ice

462

NR5A1

NR5A1

Rabbit

Steroidogenic factor 1

NM_139051

QLHALQLDRQEFVCLKFLILFSLDVKFLNNHSLVKDAQEKANAALLDYTL