
NRXN1 Konijn pAb (APR17701N)
Kwaliteit
ISO Gecertificeerd
Levering
24-48 uur
Technische Specificaties
This gene encodes a single-pass type I membrane protein that belongs to the neurexin family. Neurexins are cell-surface receptors that bind neuroligins to form Ca (2+) -dependent neurexin/neuroligin complexes at synapses in the central nervous system. This complex is required for efficient neurotransmission, and is involved in the formation of synaptic contacts. Three members of this gene family have been studied in detail and are estimated to generate over 3,000 variants through the use of two alternative promoters (alpha and beta) and extensive alternative splicing in each family member. Recently, a third promoter (gamma) was identified for this gene in the 3' region. The RefSeq project has decided to create only a few representative transcript variants of the multitude that are possible. Mutations in this gene are associated with Pitt-Hopkins-like syndrome-2.
We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NRXN1 Rabbit pAb (APR17701N) .
NRXN1; Hs.22998; PTHSL2; SCZD17
9378
P58400/Q9ULB1
Cell junction, Cell membrane, Single-pass type I membrane protein, synapse
WB 1:500 - 1:2000
Liquid
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Calculated MW: 15kDa/46kDa/161kDa/164kDa/169kDa Observed MW: 162kDa
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9378
https://www.uniprot.org/uniprot/P58400/Q9ULB1
LEFPGAEGQWTRFPKWNACCESEMSFQLKTRSARGLVLYFDDEGFCDFLELILTRGGRLQLSFSIFCAEPATLLADTPVNDGAWHSVRIRRQFRNTTLFIDQVEAKWVEVKSKRRDMTVFSGLFVGGLPPELRAAALKLTLASVREREPFKGWIRDVRVNSSQVLPVDSGEVKLDDEPPNSGGGSPCEAGEEGEGGVCLNGGVCSVVDDQAVCDCSRTGFRGKDCSQEIKFGLQCVLPVLLHDNDQGKYCCINTAKPLTEKDNNVEGLAHLMMGDQGKSK
Beschrijving
NRXN1 Konijn pAb (APR17701N) Beschikbaar in 50 µL. Bestel eenvoudig online met snelle levering.
Specificaties
Recent bekeken producten

Denhardt's Solution (50X)
EC-915
50 mL

FKBP4, ID (FK506-binding Protein 4, Peptidyl-prolyl cis-trans Isomerase FKBP4, PPIase FKBP4, Rotamase, HSP-binding Immunophilin, HBI, FKBP52 Protein, 52kD FK506-binding Protein, 52kD FKBP, FKBP-52, 59kD Immunophilin, FKBP59, p59 Protein, FKBP-4, FKBP52)
MBS623609-01
0.2 mL

West Nile Virus, NS3 Protease (WNV)
MBS603723-01
0.1 mg

Human Sertoli Cell Complete Medium
MBS2576755-01
100 mL

Urobilinogen protein
MBS5303823-01
100 mg

AffiniPure Goat Anti-Rabbit IgG H&L, HRP conjugated
GTR17765564-01
100 µL

Pribolab® Automatic Immunoaffinity Column Purification System
HWEQ-IM 5050
1 Unit

OneTaq Hot Start 2X Master Mix with GC Buffer
NEB M0485L
500 Reactions
Recent gezochte producten

FKBP4, ID (FK506-binding Protein 4, Peptidyl-prolyl cis-trans Isomerase FKBP4, PPIase FKBP4, Rotamase, HSP-binding Immunophilin, HBI, FKBP52 Protein, 52kD FK506-binding Protein, 52kD FKBP, FKBP-52, 59kD Immunophilin, FKBP59, p59 Protein, FKBP-4, FKBP52)
MBS623609-01
0.2 mL

VDAC3 (Voltage-dependent Anion-selective Channel Protein 3, VDAC-3, hVDAC3, Outer Mitochondrial Membrane Protein Porin 3) (MaxLight 750)
MBS6236090-01
0.1 mL

Vascular Endothelial Growth Factor A (VEGFA, VEGF-A, VEGF, Vascular Permeability Factor, VPF, MVCD1) (MaxLight 750)
MBS6236092-01
0.1 mL

Vascular Endothelial Growth Factor B (VEGFB, VEGF-B, VEGF-related Factor, VRF, VEGFL) (MaxLight 750)
MBS6236093-01
0.1 mL

VGFR3 (FLT4, VEGFR3, Vascular endothelial growth factor receptor 3, Fms-like tyrosine kinase 4, Tyrosine-protein kinase receptor FLT4) (MaxLight 750)
MBS6236094-01
0.1 mL

VGLL1 (Transcription Cofactor Vestigial-like Protein 1, VGL1, Vgl-1, Protein TONDU, TDU) (MaxLight 750)
MBS6236095-01
0.1 mL

VHL (Von Hippel-Lindau Disease Tumor Suppressor, pVHL, Protein G7, HRCA1, RCA1, VHL1) (MaxLight 750)
MBS6236096-01
0.1 mL

Villin-1 (VIL1, VIL, D2S1471) (MaxLight 750)
MBS6236097-01
0.1 mL
